PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g051590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 161aa    MW: 18405.8 Da    PI: 9.0644
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g051590.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-191368156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r k+ ++t+eql++Le++F  n+++  + + +L++klgL++rqV vWFqN+Ra+ k
  Csa02g051590.1 13 RNKKKRLTQEQLRQLEKCFTVNKKLEPDLKIQLSNKLGLPQRQVAVWFQNKRARSK 68
                    567889************************************************99 PP

2HD-ZIP_I/II99.72.7e-3214106193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kk+rl++eq+++LE++F+ ++kLep+ K +l+++Lgl +rqvavWFqn+RAR kt+ lE ++ aL+++++a  +++++Le++v+ L++elk+
  Csa02g051590.1  14 NKKKRLTQEQLRQLEKCFTVNKKLEPDLKIQLSNKLGLPQRQVAVWFQNKRARSKTQSLELQHCALQSKLEAALSDKAKLEHQVQFLQDELKR 106
                     59****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-18771IPR009057Homeodomain-like
PROSITE profilePS5007117.3621070IPR001356Homeobox domain
SMARTSM003897.8E-181274IPR001356Homeobox domain
PfamPF000461.2E-161368IPR001356Homeobox domain
CDDcd000861.47E-151371No hitNo description
Gene3DG3DSA:1.10.10.601.9E-181673IPR009057Homeodomain-like
PROSITE patternPS0002704568IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MNFFSINAIS QSRNKKKRLT QEQLRQLEKC FTVNKKLEPD LKIQLSNKLG LPQRQVAVWF  60
QNKRARSKTQ SLELQHCALQ SKLEAALSDK AKLEHQVQFL QDELKRSRNQ LALFTNHDSP  120
VCNSNLGSCE ERHDDEVVVF DELYACFVSN GHGSSSTSWV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076441e-165AB007644.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone: K19P17.
GenBankAK2292111e-165AK229211.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-49-M21.
GenBankBT0159271e-165BT015927.1 Arabidopsis thaliana At5g53980 mRNA, complete cds.
GenBankBT0219201e-165BT021920.1 Arabidopsis thaliana At5g53980 gene, complete cds.
GenBankCP0026881e-165CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446316.11e-108PREDICTED: homeobox-leucine zipper protein ATHB-52-like
SwissprotQ9FN296e-98ATB52_ARATH; Homeobox-leucine zipper protein ATHB-52
TrEMBLD7MTN02e-99D7MTN0_ARALL; ATHB52
STRINGfgenesh2_kg.8__1293__AT5G53980.15e-99(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.13e-99homeobox protein 52